Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Brucella abortus sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q2YKR7

Expression Region

1-282

Origin

Brucella abortus (strain 2308)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASSMTSTQIIRPPISLLPGDHLVENYRE AIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFAIVFFRFPMRMFFFWMIFI TLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARI DNAGPFRFMRDILLPLSKTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVD WADASTPWNYVMVTAILAIIPLILVVVLMQRWFVKGLVETEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO2A Polyclonal Antibody
E-AB-90858-01 60 µL

CORO2A Polyclonal Antibody

Sign In for Pricing
View Details
CORO2A Polyclonal Antibody
E-AB-90858-02 120 µL

CORO2A Polyclonal Antibody

Sign In for Pricing
View Details
CORO2A Polyclonal Antibody
E-AB-90858-03 200 µL

CORO2A Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Collagen α-1 (III) Chain/COL3A1 Protein (His Tag)
PKSM040988-01 10 µg

Recombinant Mouse Collagen α-1 (III) Chain/COL3A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Collagen α-1 (III) Chain/COL3A1 Protein (His Tag)
PKSM040988-02 50 µg

Recombinant Mouse Collagen α-1 (III) Chain/COL3A1 Protein (His Tag)

Sign In for Pricing
View Details
RBM23 (NM_001077352) Human Over-expression Lysate
LC421401 20 µg

RBM23 (NM_001077352) Human Over-expression Lysate

Sign In for Pricing
View Details