Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Brucella suis biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q8FW08

Expression Region

1-282

Origin

Brucella suis biovar 1 (strain 1330)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASLMTSTQIIRPPISLLPGDHLVENYRE AIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFAIVFFRFPMRMFFFWMIFI TLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARI DNAGPFRFMRDILLPLSKTNIAALFVILSIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVD WADASTSWNYVMVTAILAIIPPILVVVLMQRWFVKGLVETEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details