Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q8UB30

Expression Region

1-282

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRPIARVIAHLMLVLGIIIVAFPIYYTFIASSMTSNDIIRPPMSLLPGDHLSANYTE AMVGGVERVVGVSLERLLFNSFVVALAIAIGKIVISFLSAFAIVFFRFPFRMGFFWMIFI TLMLPVEVRILPTYKVIVDLGLIDTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARI DNAGPFRFMRDILLPLSRTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLKRMVD FTDASTPWNYVMVTAILAIIPPVMVVVLMQRWFVKGLVETEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL
BNC940956-100 1x 100 µL

UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF594 conjugate, 0.1mg/mL
BNC942383-500 1x 500 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF640R conjugate, 0.1mg/mL
BNC401714-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details