Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q8UB30

Expression Region

1-282

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRPIARVIAHLMLVLGIIIVAFPIYYTFIASSMTSNDIIRPPMSLLPGDHLSANYTE AMVGGVERVVGVSLERLLFNSFVVALAIAIGKIVISFLSAFAIVFFRFPFRMGFFWMIFI TLMLPVEVRILPTYKVIVDLGLIDTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARI DNAGPFRFMRDILLPLSRTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLKRMVD FTDASTPWNYVMVTAILAIIPPVMVVVLMQRWFVKGLVETEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM139 (NM_001282876) Human Tagged ORF Clone
RG236639 10 µg

TMEM139 (NM_001282876) Human Tagged ORF Clone

Sign In for Pricing
View Details
OR4Q3 Antibody
8G613-AAT 50 µg

OR4Q3 Antibody

Sign In for Pricing
View Details
Recombinant HOOK2 Antibody
RC-16518-01 50 μL

Recombinant HOOK2 Antibody

Sign In for Pricing
View Details
Recombinant HOOK2 Antibody
RC-16518-02 100 µL

Recombinant HOOK2 Antibody

Sign In for Pricing
View Details
Recombinant HOOK2 Antibody
RC-16518-03 1 mL

Recombinant HOOK2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Gastroesophageal junction
CR560619 5 µg

Tissue Total RNA, Gastroesophageal junction

Sign In for Pricing
View Details