Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q9CC42

Expression Region

1-282

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAVSAMSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVA VLVYFGRDIVRILHAWCRGLTVTLHRTADYWLGWYVIIGTIPICILGLVCKDEIRSGIRP LWVVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALVVGVAQTLALIPGVSRSGSTISA GLFLGLDRELAARFGFLLAIPAVFASGLFSIPDAFHPITEGMSATGAQLLVATVIAFVVG LVAVSWLLRFLVQHNLYWFVGYRIVVGVGVLILLAVKTVAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Denatonium Saccharide
TRC-D231705-5G 5 g

Denatonium Saccharide

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702961 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
GSK 321
TRC-G797305-2.5MG 2.5 mg

GSK 321

Sign In for Pricing
View Details
Slc39a12 Mouse Gene Knockout Kit (CRISPR)
KN516103 1 Kit

Slc39a12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL
BNC430999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAMK2A Human Gene Knockout Kit (CRISPR)
KN205202LP 1 Kit

CAMK2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details