Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q9CC42

Expression Region

1-282

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAVSAMSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVA VLVYFGRDIVRILHAWCRGLTVTLHRTADYWLGWYVIIGTIPICILGLVCKDEIRSGIRP LWVVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALVVGVAQTLALIPGVSRSGSTISA GLFLGLDRELAARFGFLLAIPAVFASGLFSIPDAFHPITEGMSATGAQLLVATVIAFVVG LVAVSWLLRFLVQHNLYWFVGYRIVVGVGVLILLAVKTVAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndecan 4 (SDC4) (NM_002999) Human Over-expression Lysate
LY401051 100 µg

Syndecan 4 (SDC4) (NM_002999) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein A/G Coated - 96 well Solid plates - Black PS
MCB08F-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
ST6GALNAC1 (NM_018414) Human Over-expression Lysate
LC402680 20 µg

ST6GALNAC1 (NM_018414) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 6B (KRT6B) Rabbit Polyclonal Antibody
TA362052 100 µL

Cytokeratin 6B (KRT6B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H2]
TA804923BM 100 µL

UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H2]

Sign In for Pricing
View Details
Indole-5-carboxylic Acid
TRC-I627005-1G 1 g

Indole-5-carboxylic Acid

Sign In for Pricing
View Details