Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a)

This Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O08564

Expression Region

1-282

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKPRLPYVVLDVICVLLAGLPFIILTSRHTPFQRGVFCTDESIKYPYREDTIPYALLG GIVIPFCIIVMITGETLSVYFNVLHSNSFVSNHYIATIYKAVGAFLFGASASQSLTDIAK YSIGRLRPHFLAVCNPDWSKINCSDGYIENFVCQGNEQKVREGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPMLQFGLVALSIYVGLSRVSDYKHHWSDVLIGLIQGAVVAI LVVLYVTDFFKTTESNKERKEDSHTTLHETTNRQSYARNHEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1 (CD1D) (NM_001766) Human Over-expression Lysate
LC400670 20 µg

CD1 (CD1D) (NM_001766) Human Over-expression Lysate

Sign In for Pricing
View Details
ARID5A Human Gene Knockout Kit (CRISPR)
KN416294 1 Kit

ARID5A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL-5RA Rabbit Polyclonal Antibody
HA500303 100 µL

IL-5RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRF7 Human Gene Knockout Kit (CRISPR)
KN417874 1 Kit

IRF7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTAP Recombinant Rabbit Monoclonal Antibody [JE63-74]
HA721955 100 µL

MTAP Recombinant Rabbit Monoclonal Antibody [JE63-74]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD62L Antibody[DREG56]
E-AB-F1051T3-01 20 Tests

Elab Fluor® Violet 540 Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details