Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a)

This Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O08564

Expression Region

1-282

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKPRLPYVVLDVICVLLAGLPFIILTSRHTPFQRGVFCTDESIKYPYREDTIPYALLG GIVIPFCIIVMITGETLSVYFNVLHSNSFVSNHYIATIYKAVGAFLFGASASQSLTDIAK YSIGRLRPHFLAVCNPDWSKINCSDGYIENFVCQGNEQKVREGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPMLQFGLVALSIYVGLSRVSDYKHHWSDVLIGLIQGAVVAI LVVLYVTDFFKTTESNKERKEDSHTTLHETTNRQSYARNHEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS801166 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Recombinant p53 (phospho S392) Antibody
RC-16341-01 50 μL

Recombinant p53 (phospho S392) Antibody

Sign In for Pricing
View Details
Recombinant p53 (phospho S392) Antibody
RC-16341-02 100 µL

Recombinant p53 (phospho S392) Antibody

Sign In for Pricing
View Details
Recombinant p53 (phospho S392) Antibody
RC-16341-03 1 mL

Recombinant p53 (phospho S392) Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS806350 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
EAP30 (SNF8) Human Gene Knockout Kit (CRISPR)
KN402137 1 Kit

EAP30 (SNF8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details