Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a)

This Recombinant Rat Lipid phosphate phosphohydrolase 1 (Ppap2a) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O08564

Expression Region

1-282

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKPRLPYVVLDVICVLLAGLPFIILTSRHTPFQRGVFCTDESIKYPYREDTIPYALLG GIVIPFCIIVMITGETLSVYFNVLHSNSFVSNHYIATIYKAVGAFLFGASASQSLTDIAK YSIGRLRPHFLAVCNPDWSKINCSDGYIENFVCQGNEQKVREGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPMLQFGLVALSIYVGLSRVSDYKHHWSDVLIGLIQGAVVAI LVVLYVTDFFKTTESNKERKEDSHTTLHETTNRQSYARNHEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL
BNC940375-500 1x 500 µL

P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP90AA1 / HSP90 alpha Rabbit Polyclonal Antibody
AP06175PU-N 100 µg

HSP90AA1 / HSP90 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H2]
TA504964BM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H2]

Sign In for Pricing
View Details
PAEP (NM_002571) Human Over-expression Lysate
LY419242 100 µg

PAEP (NM_002571) Human Over-expression Lysate

Sign In for Pricing
View Details
Ibuprofen Alcohol
TRC-I140045-1G 1 g

Ibuprofen Alcohol

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), 0.2mg/mL
BNUB3495-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), 0.2mg/mL

Sign In for Pricing
View Details