Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azoarcus sp. ATP synthase subunit a (atpB)

This Recombinant Azoarcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1K1R6

Expression Region

1-282

Origin

Azoarcus sp. (strain BH72)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEHAPTASEYVVHHLTHLNSTGHAQTSIVDFSVINVDSMFYSVLLGLLTVFLLWLAAR KATAGVPGRFQGFVELLVEMVADQAKGIIHSAESRKFVAPLALTVFVWIFLMNAMDMLPV DLLPRIWEGVYASAGGDPHHAYMRVVPTADLSATLGMSCGVLLLCLYYNVKIKGVSGWVH ELFTAPFGSHPLLYPINFAMQIIEFVAKTVSHGMRLFGNMYAGELIFILIALLGSTATVF GFVGHIVAGSIWAIFHILIITLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, Murine Isotype Control (PE/Texas Red) discontinued
I1904-14U9 100 µg

IgG, Murine Isotype Control (PE/Texas Red) discontinued

Sign In for Pricing
View Details
ZNF138 Antibody
GWB-MQ848B 50 µg

ZNF138 Antibody

Sign In for Pricing
View Details
Mouse MEGF10 shRNA Plasmid
abx977205-01 150 µg

Mouse MEGF10 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MEGF10 shRNA Plasmid
abx977205-02 300 µg

Mouse MEGF10 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM156 Antibody
NBP3-06638-100ul 100 µL

Rabbit Polyclonal TMEM156 Antibody

Sign In for Pricing
View Details
SLC25A26 (NM_173471) Human Tagged ORF Clone Lentiviral Particle
RC216404L4V 200 µL

SLC25A26 (NM_173471) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details