Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azoarcus sp. ATP synthase subunit a (atpB)

This Recombinant Azoarcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1K1R6

Expression Region

1-282

Origin

Azoarcus sp. (strain BH72)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEHAPTASEYVVHHLTHLNSTGHAQTSIVDFSVINVDSMFYSVLLGLLTVFLLWLAAR KATAGVPGRFQGFVELLVEMVADQAKGIIHSAESRKFVAPLALTVFVWIFLMNAMDMLPV DLLPRIWEGVYASAGGDPHHAYMRVVPTADLSATLGMSCGVLLLCLYYNVKIKGVSGWVH ELFTAPFGSHPLLYPINFAMQIIEFVAKTVSHGMRLFGNMYAGELIFILIALLGSTATVF GFVGHIVAGSIWAIFHILIITLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHPX Lentiviral Activation Particles (m2)
sc-423164-LAC-2 200 µL

NHPX Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
LHX2 Mouse Monoclonal Antibody [Clone:1A2]
E45M19547 100 µg

LHX2 Mouse Monoclonal Antibody [Clone:1A2]

Sign In for Pricing
View Details
Human Urocortin 3 (UCN3) ELISA Kit
MBS455251-01 48 Tests

Human Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details
Human Urocortin 3 (UCN3) ELISA Kit
MBS455251-02 96 Tests

Human Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details
Human Urocortin 3 (UCN3) ELISA Kit
MBS455251-03 5x 96 Tests

Human Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details
Human Urocortin 3 (UCN3) ELISA Kit
MBS455251-04 10x 96 Tests

Human Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details