Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atriplex canescens Aquaporin PIP-type

This Recombinant Atriplex canescens Aquaporin PIP-type spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Aquaporin PIP-type

UniProt

P42767

Expression Region

1-282

Origin

Atriplex canescens (Fourwing saltbush) (Calligonum canescens)

Field of Research

Kidney & Urological Research; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEVISEEGQVHQHGKDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLYITVATV IGYKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRA LVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVYTV FSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKKRVW DDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFRSNPTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC681204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details
ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL
BNC680811-500 1x 500 µL

ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details