Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Phosphate transport system permease protein pstA (pstA)

This Recombinant Haemophilus influenzae Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

P45190

Expression Region

1-282

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTNQNLRFYWRKTHNKLMLGLSYISVIIGLFWLCWILFTLITKGIPALSIDLFTQSTPA PNEKGGLLNALIGSFFIVGAGTLIGTPIGVLAGTYLAEYGRYSRFAQITRFLNDILLSAP SIIIGLFVYSLYVSKIEHFSGWAGAFALALLLIPIVVRTTDNMLLLVPNNLREAAAALGC SQWQVIMMICYRAAKSGILTGVLLAVARISGETAPLLFTALSNQFLSWNMNEPIANLPVV IYQYAASPFTDWNNLAWAGAALITLFVLCLNIFTRLFFQHKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL
BNC040670-100 1x 100 µL

CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL
BNC040725-500 1x 500 µL

DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details