Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IFN gamma

IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.

Product Specifications

Synonyms

Mouse ; IFN gamma

Label

ICT

Type

Recombinant Protein

Source

Yeast

Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133)

Assay Protocol

The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Form

Lyophilized

Shipping Conditions

Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping

Storage Temperature

-20°C

Notes

20% discount

Calculated Molecular Weight

15.5 kDa

Target Description

Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs., , IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects., , IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-4 / ERBB4 (ERBB4/2581), CF488A conjugate, 0.1mg/mL
BNC882581-500 1x 500 µL

HER-4 / ERBB4 (ERBB4/2581), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp518b Mouse Gene Knockout Kit (CRISPR)
KN519865 1 Kit

Zfp518b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Calbindin Monoclonal Antibody
AN301778L-01 50 µL

Recombinant Calbindin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Calbindin Monoclonal Antibody
AN301778L-02 100 µL

Recombinant Calbindin Monoclonal Antibody

Sign In for Pricing
View Details
Propionaldehyde-2,2,3,3,3-d5
TRC-P782501-5MG 5 mg

Propionaldehyde-2,2,3,3,3-d5

Sign In for Pricing
View Details
PDE6 gamma (PDE6G) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]
TA503739AM 100 µL

PDE6 gamma (PDE6G) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details