Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Product Specifications

Synonyms

Mouse ;IL-10

Label

ICT

Type

Recombinant Protein

Source

Yeast

Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Assay Protocol

The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Form

Lyophilized

Shipping Conditions

Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping

Storage Temperature

-20°C

Notes

20% discount

Calculated Molecular Weight

18.8 kDa

Target Description

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms., , IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R3C Recombinant Protein Antigen
NBP1-87236PEP 0.1 mL

PPP1R3C Recombinant Protein Antigen

Sign In for Pricing
View Details
Melanoma (250, >450kDa) Mouse Monoclonal Antibody [Clone ID: NKI-M6]
AM32145PU-N 1 mL

Melanoma (250, >450kDa) Mouse Monoclonal Antibody [Clone ID: NKI-M6]

Sign In for Pricing
View Details
CD240D/RHD Human Monoclonal Antibody (PE)
orb2970687-01 50 Tests

CD240D/RHD Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details
CD240D/RHD Human Monoclonal Antibody (PE)
orb2970687-02 100 Tests

CD240D/RHD Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human Polyunsaturated Fatty Acid Lipoxygenase ALOX12 (ALOX12) CLIA Kit
abx493304-01 96 Tests

Human Polyunsaturated Fatty Acid Lipoxygenase ALOX12 (ALOX12) CLIA Kit

Sign In for Pricing
View Details
Human Polyunsaturated Fatty Acid Lipoxygenase ALOX12 (ALOX12) CLIA Kit
abx493304-02 5x 96 Tests

Human Polyunsaturated Fatty Acid Lipoxygenase ALOX12 (ALOX12) CLIA Kit

Sign In for Pricing
View Details