Recombinant Mouse IL-6

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Its role as an anti-inflammatory cytokine is mediated through its inhibitory effects on TNF-alpha and IL-1, and activation of IL-1ra and IL-10., , IL-6 is secreted by T cells and macrophages to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation. IL-6 is also produced from muscle, and its levels are elevated in response to muscle contraction. Its levels are significantly elevated with exercise, and IL-6 precedes the appearance of other cytokines in the circulation. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine., , The biological activity of Recombinant Mouse IL-6 was verified by proliferation of 7TD1 cells, a mouse IL-6-dependant B-cell hybridoma cell line. Briefly, 7TD1 cells were incubated with various concentrations of recombinant Mouse IL-6 protein in a dose dependent manner in complete medium containing 10% calf serum and Gentamicin for 64 hours at 37°C, 5% CO2 in a 96-Well tissue culture plate. Cell proliferation was measured utilizing Promega Substrate Cell Titer 96 Aqueous One Solution Reagent and measuring the optical density of the final solution at 490 nm. The ED50 of Recombinant Mouse IL-6 protein was determined to be 0.006-0.009 ng/ml.