Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.

Product Specifications

Synonyms

Mouse ; TNF alpha

Label

ICT

Type

Recombinant Protein

Source

Yeast

Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Assay Protocol

The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.

Form

Lyophilized

Shipping Conditions

Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping

Storage Temperature

-20°C

Notes

20% discount

Calculated Molecular Weight

17.3 kDa

Target Description

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-01 20 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-02 50 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-03 100 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Trans-Trideuteromethyl-3- (5′-carboxy-3′-methyl-2’-pentenyl) -1,4-naphthoquinone-5,6,7,8-D4
467951 500 µg

Trans-Trideuteromethyl-3- (5′-carboxy-3′-methyl-2’-pentenyl) -1,4-naphthoquinone-5,6,7,8-D4

Sign In for Pricing
View Details
Human ACTN3 (Actinin Alpha 3) Microsample ELISA Kit
ELK5224MS-01 48 Tests

Human ACTN3 (Actinin Alpha 3) Microsample ELISA Kit

Sign In for Pricing
View Details
Human ACTN3 (Actinin Alpha 3) Microsample ELISA Kit
ELK5224MS-02 96 Tests

Human ACTN3 (Actinin Alpha 3) Microsample ELISA Kit

Sign In for Pricing
View Details