Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Rhomboid protein 2 (RBD2)

This Recombinant Candida albicans Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q5AH12

Expression Region

1-284

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINFDEFPPKYDPSLRPPALTTGLIVFTFMLCVIKSVTSYTFESLILYPRAPLDLNLNSI SLYSLFHVNFFHWICNIFTLATPLAVFETRNGTIHTGVTLNLLTVIAALQYCIVGLIFYP NTGVIGLSGIAFSLMSYMAYHESKFRPIMHTFHLSNSLEIKLYTLYVPFVVAIVFMILFP SSSLPGHLFGITTGYLLSYGYIDKLYPPSKVITTIENKLSSLINFLELIVTFYKEEESLV TRGSVGYKPLFNQDIEHGAANAASHGSSAFVGETRVLGTRESTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) amino]butanoic acid
UTB56575-01 50 mg

3-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) amino]butanoic acid

Sign In for Pricing
View Details
3-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) amino]butanoic acid
UTB56575-02 0.5 g

3-[ (1,1-Dioxo-1,2-benzothiazol-3-yl) amino]butanoic acid

Sign In for Pricing
View Details
DCHS1 Antibody, FITC conjugated
CSB-PA850320OC01HU-01 50 μL

DCHS1 Antibody, FITC conjugated

Sign In for Pricing
View Details
DCHS1 Antibody, FITC conjugated
CSB-PA850320OC01HU-02 100 µL

DCHS1 Antibody, FITC conjugated

Sign In for Pricing
View Details
4- (Chloromethyl) -N-cyclopropylbenzamide
429431-01 100 mg

4- (Chloromethyl) -N-cyclopropylbenzamide

Sign In for Pricing
View Details
4- (Chloromethyl) -N-cyclopropylbenzamide
429431-02 250 mg

4- (Chloromethyl) -N-cyclopropylbenzamide

Sign In for Pricing
View Details