Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A)

This Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O14494

Expression Region

1-284

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP12 Human Gene Knockout Kit (CRISPR)
KN214439LP 1 Kit

AKAP12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1R,5R,6R)-rel-5-(1-Ethylpropoxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester
TRC-E925695-25MG 25 mg

(1R,5R,6R)-rel-5-(1-Ethylpropoxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Metribuzin DK
TRC-M339088-50MG 50 mg

Metribuzin DK

Sign In for Pricing
View Details
CD8B Human Gene Knockout Kit (CRISPR)
KN415505 1 Kit

CD8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse 4930572O13Rik activation kit by CRISPRa
GA210382 1 Kit

Mouse 4930572O13Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS707081 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details