Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A)

This Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O14494

Expression Region

1-284

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-,  10nm
GP-1104-10 1 mL

Colloidal Gold Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-, 10nm

Sign In for Pricing
View Details
LYK5 (STRADA) (NM_001165970) Human Over-expression Lysate
LY431260 100 µg

LYK5 (STRADA) (NM_001165970) Human Over-expression Lysate

Sign In for Pricing
View Details
MEK3 (MAP2K3) (NM_145109) Human Over-expression Lysate
LY403425 100 µg

MEK3 (MAP2K3) (NM_145109) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), 0.2mg/mL
BNUB0898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), 0.2mg/mL

Sign In for Pricing
View Details
alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA501789BM 100 µL

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
NUR77 (NR4A1) Rabbit Polyclonal Antibody
AP13294PU-N 400 µL

NUR77 (NR4A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details