Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A)

This Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O14494

Expression Region

1-284

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MultiTherm™ Shaker with heating only, 230V
H5000-H-E 1 Each

MultiTherm™ Shaker with heating only, 230V

Sign In for Pricing
View Details
CD4 (C4/206), CF405M conjugate, 0.1mg/mL
BNC050206-100 1x 100 µL

CD4 (C4/206), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPS27 Rabbit Polyclonal Antibody
AP21074PU-N 100 µg

MRPS27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mix-n-StainTM STORM CF®750 Antibody Labeling Kit, 1x50ug labeling
#92557 1 Kit

Mix-n-StainTM STORM CF®750 Antibody Labeling Kit, 1x50ug labeling

Sign In for Pricing
View Details
Human ADCY4 activation kit by CRISPRa
GA116288 1 Kit

Human ADCY4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS625168 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details