Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marinobacter aquaeolei ATP synthase subunit a (atpB)

This Recombinant Marinobacter aquaeolei ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1U7I0

Expression Region

1-284

Origin

Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845) )

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADTPVEYIKHHLTNLTYGKLPEGYERADGSVVQEATWTFARTGQEATDMGFMAIHVDT LGWSIAMGILFLGLFRFVANRVTEGTPSGLQNLIEMTFEFVQGIVRDVFHGKNPLIAPLA LTIFVWILLMNILKLIPIDYIPSIAHALGLEYFKIVPTTDPNATFGMSIGVFLLILFYSF KVKGVSGFSKELAFNPFNHWIMIPFNLLLEILALIIKPISLALRLFGNMYAGEVVFILIA LLPLWIQWTLNVPWAIFHILVIPLQAFIFTVLTVVYLSAAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF640R conjugate, 0.1mg/mL
BNC401541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF405S conjugate, 0.1mg/mL
BNC041862-500 1x 500 µL

CD79a (B-Cell Marker) (rIGA/764), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLC3 (NM_177417) Human Recombinant Protein
TP309427L 1 mg

KLC3 (NM_177417) Human Recombinant Protein

Sign In for Pricing
View Details
Wtip Mouse Gene Knockout Kit (CRISPR)
KN519474 1 Kit

Wtip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCNF (NR6A1) (NM_001489) Human Over-expression Lysate
LC419899 20 µg

GCNF (NR6A1) (NM_001489) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS700866 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details