Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marinobacter aquaeolei ATP synthase subunit a (atpB)

This Recombinant Marinobacter aquaeolei ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1U7I0

Expression Region

1-284

Origin

Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845) )

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADTPVEYIKHHLTNLTYGKLPEGYERADGSVVQEATWTFARTGQEATDMGFMAIHVDT LGWSIAMGILFLGLFRFVANRVTEGTPSGLQNLIEMTFEFVQGIVRDVFHGKNPLIAPLA LTIFVWILLMNILKLIPIDYIPSIAHALGLEYFKIVPTTDPNATFGMSIGVFLLILFYSF KVKGVSGFSKELAFNPFNHWIMIPFNLLLEILALIIKPISLALRLFGNMYAGEVVFILIA LLPLWIQWTLNVPWAIFHILVIPLQAFIFTVLTVVYLSAAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3AP1 Antibody
KC-3471-01 50 μL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3471-02 100 µL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3471-03 1 mL

PIK3AP1 Antibody

Sign In for Pricing
View Details
REV1 (NM_016316) Human Over-expression Lysate
LY402538 100 µg

REV1 (NM_016316) Human Over-expression Lysate

Sign In for Pricing
View Details
LMO2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]
TA506139AM 100 µL

LMO2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI1D11]
CF810172 100 µg

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

Sign In for Pricing
View Details