Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter 1 (focA)

This Recombinant Probable formate transporter 1 (focA) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Probable formate transporter 1, Formate channel 1

UniProt

P0AC24

Expression Region

1-285

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]
TA800823AM 100 µL

CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-01 20 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-02 100 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody
AP50359PU-N 400 µL

bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Striatin (STRN) (NM_003162) Human Over-expression Lysate
LY418852 100 µg

Striatin (STRN) (NM_003162) Human Over-expression Lysate

Sign In for Pricing
View Details