Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter 1 (focA)

This Recombinant Probable formate transporter 1 (focA) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Probable formate transporter 1, Formate channel 1

UniProt

P0AC24

Expression Region

1-285

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL
BNC041707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Hydroxy-3-(4-(4-hydroxy-3,5-diiodophenoxy)-3,5-dinitrophenyl)propanoic acid
TRC-H942968-250MG 250 mg

2-Hydroxy-3-(4-(4-hydroxy-3,5-diiodophenoxy)-3,5-dinitrophenyl)propanoic acid

Sign In for Pricing
View Details
Ethyl Benzoylformate-d5
TRC-E899987-250MG 250 mg

Ethyl Benzoylformate-d5

Sign In for Pricing
View Details
RBM44 Human Gene Knockout Kit (CRISPR)
KN416835 1 Kit

RBM44 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL
BNC743298-100 1x 100 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM171 (NM_001161342) Human Over-expression Lysate
LC431851 20 µg

TMEM171 (NM_001161342) Human Over-expression Lysate

Sign In for Pricing
View Details