Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter 1 (focA)

This Recombinant Probable formate transporter 1 (focA) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Probable formate transporter 1, Formate channel 1

UniProt

P0AC25

Expression Region

1-285

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dihydroperillic Acid
TRC-D454688-10MG 10 mg

1,2-Dihydroperillic Acid

Sign In for Pricing
View Details
Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]
AM09370PU-S 50 µL

Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: AT10F1]

Sign In for Pricing
View Details
Rat Cyclic ADP Ribose Hydrolase (cADPRH) ELISA Kit
RDR-cADPRH-Ra-01 96 Tests

Rat Cyclic ADP Ribose Hydrolase (cADPRH) ELISA Kit

Sign In for Pricing
View Details
Rat Cyclic ADP Ribose Hydrolase (cADPRH) ELISA Kit
RDR-cADPRH-Ra-02 48 Tests

Rat Cyclic ADP Ribose Hydrolase (cADPRH) ELISA Kit

Sign In for Pricing
View Details
Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)
KN201278RB 1 Kit

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pstpip1 Mouse Gene Knockout Kit (CRISPR)
KN514144 1 Kit

Pstpip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details