Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable formate transporter 1 (focA)

This Recombinant Probable formate transporter 1 (focA) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Probable formate transporter 1, Formate channel 1

UniProt

P0AC25

Expression Region

1-285

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indo-1, pentapotassium salt *CAS 132319-56-3*
21040-AAT 1 mg

Indo-1, pentapotassium salt *CAS 132319-56-3*

Sign In for Pricing
View Details
Fluorescent Brightener 71 (~65%)
TRC-F596080-2.5G 2.5 g

Fluorescent Brightener 71 (~65%)

Sign In for Pricing
View Details
Interferon gamma Antibody
KC-043-01 50 μL

Interferon gamma Antibody

Sign In for Pricing
View Details
Interferon gamma Antibody
KC-043-02 100 µL

Interferon gamma Antibody

Sign In for Pricing
View Details
Interferon gamma Antibody
KC-043-03 1 mL

Interferon gamma Antibody

Sign In for Pricing
View Details
DDB1 Recombinant Rabbit Monoclonal Antibody [JU32-35]
ET1706-22 100 µL

DDB1 Recombinant Rabbit Monoclonal Antibody [JU32-35]

Sign In for Pricing
View Details