Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas haloplanktis ATP synthase subunit a (atpB)

This Recombinant Pseudoalteromonas haloplanktis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3IK44

Expression Region

1-285

Origin

Pseudoalteromonas haloplanktis (strain TAC 125)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEEVTLSSHIQHHLTNAKMCSTDAGLAFNKACADSGFWTWHVDTLAWSIGLGLIFLWI FRSAAKKSTLGVPGKFQCFIEIIVEFVGDNVRDTFHGKSKLIAPLALTIFVWVFLMNLMD LIPVDFLPSFAGFVGETAFGMDSHDVYMKIVPTTDINMTSALALGVFILMVGFAIKIKGI GGFIKELTLHPFSSNNVFVQILLIPFNLLLELIALVSKPFSLALRLFGNLYAGELIFILI GAIGFMQLPLHFVWAVFHILVITLQAFLFMMLTIVYLSMASSDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-500 1x 500 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF647 conjugate, 0.1mg/mL
BNC470954-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL
BNC941981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF647 conjugate, 0.1mg/mL
BNC471486-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details