Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Lipid phosphate phosphohydrolase 1 (PPAP2A)

This Recombinant Guinea pig Lipid phosphate phosphohydrolase 1 (PPAP2A) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 1, EC= 3.1.3.4, PAP2-alpha, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, PAP-2a, PAP2a

UniProt

O88956

Expression Region

1-285

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDKARLPYVALDVLCVVLAGLPFAILTSRHTPFQRGIFCNDESIKYPYKEDTIPYALLG GIMIPFSIVVMIIGETLSVYCNLLHSNSFIRNNYIATIYKSIGTFLFGAAASQSLTDIAK YSIGRLRPHFLSVCDPDWSKVNCSDGYIEYYVCRGNAEKVKEGRLSFYSGHSSFSMYCMV FVALYLQARMKGDWARLLRPTLQFGLVAASIYVGLSRISDYKHHWSDVLTGLIQGAIVAI LVAVYVSDFFKARNSPFQERKEEDSHTTLHETPTAGNHYRSNHQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details