Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Sulfate transport system permease protein CysW (cysW)

This Recombinant Synechococcus elongatus Sulfate transport system permease protein CysW (cysW) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Sulfate transport system permease protein CysW

UniProt

P27370

Expression Region

1-286

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAFVKARRQIAGVKESKSLLPLALIGISLLYVGLIIIIPAANVAVQAFSEGLSGFIKNL GDRNLQEAIRLTLLMGVISVPLNTLFGLAAAFAIARKQFPGKSLLLSVIDLPFSISPVVA GLMIVLLYGRNGWLGPLLESNDIKIIFAWPGMALATIFVSMPFVAREVIPNLEEIGTDAE EAASTLGANGWQTFWRVTLPSIKWSMLYGVVLTTARALGEFGAVSVVSGSITGKTQTLPL FVEEAYKQYQTTLSYTAALLLGGISLVTLVLKALLEARTGRQSRIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF488A conjugate, 0.1mg/mL
BNC882747-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF568 conjugate, 0.1mg/mL
BNC682590-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details