Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2133 (AF_2133)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2133 (AF_2133) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2133

UniProt

O28147

Expression Region

1-286

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIALLLISYQLIKHGYRAADIKNLYTILEGEELRRQKDLSAKLRWGIVDEILWTIIVAN GAILFTAHYVLIGLKILDLIAIFVVMLSGVMLYAPLAFLFLYPVVRAFEKNFPPSNPQFL LSHGLICTVSSLIVYEKLEQLWWDPLLVGFFWIAAGFVSFFTNRRFEVLVFLLLIAPLAL LSVKCPGAILPILLAKSECSLRIQATFLVKLAVLIFASLAAVALVLQVFGYKSLRELSEK RKAAIKQGKYNPLRDPIIWIAWIMLTSLGLLIASFMERGEISPNML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamin A + Lamin C Recombinant Mouse monoclonal Antibody
HA610149 100 µg

Lamin A + Lamin C Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
3,3',5-Triiodo Thyroacetic Acid
TRC-T795320-250MG 250 mg

3,3',5-Triiodo Thyroacetic Acid

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) (NM_207170) Human Over-expression Lysate
LC404061 20 µg

GCIP interacting protein p29 (SYF2) (NM_207170) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SUSD2 activation kit by CRISPRa
GA111157 1 Kit

Human SUSD2 activation kit by CRISPRa

Sign In for Pricing
View Details
-86°C ULT Freezer Upright BFUR-86-302
BFUR-86-302 Each

-86°C ULT Freezer Upright BFUR-86-302

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS629257 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details