Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2133 (AF_2133)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2133 (AF_2133) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2133

UniProt

O28147

Expression Region

1-286

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIALLLISYQLIKHGYRAADIKNLYTILEGEELRRQKDLSAKLRWGIVDEILWTIIVAN GAILFTAHYVLIGLKILDLIAIFVVMLSGVMLYAPLAFLFLYPVVRAFEKNFPPSNPQFL LSHGLICTVSSLIVYEKLEQLWWDPLLVGFFWIAAGFVSFFTNRRFEVLVFLLLIAPLAL LSVKCPGAILPILLAKSECSLRIQATFLVKLAVLIFASLAAVALVLQVFGYKSLRELSEK RKAAIKQGKYNPLRDPIIWIAWIMLTSLGLLIASFMERGEISPNML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXDC1 Antibody
KC-7725-01 50 μL

PLXDC1 Antibody

Sign In for Pricing
View Details
PLXDC1 Antibody
KC-7725-02 100 µL

PLXDC1 Antibody

Sign In for Pricing
View Details
PLXDC1 Antibody
KC-7725-03 1 mL

PLXDC1 Antibody

Sign In for Pricing
View Details
GAGE1 (NM_001040663) Human Over-expression Lysate
LC421804 20 µg

GAGE1 (NM_001040663) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Sh3pxd2a activation kit by CRISPRa
GA201424 1 Kit

Mouse Sh3pxd2a activation kit by CRISPRa

Sign In for Pricing
View Details
CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL
BNC880877-100 1x 100 µL

CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details