Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Rhomboid protein 2 (RBD2)

This Recombinant Debaryomyces hansenii Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q6BSA9

Expression Region

1-286

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSPSFINKLALPNLATITQYPALTVGLSVFTFLLLVIDLCSNQALSQKFSLYPNAPFEF DLNRLSFYLLFHRGFTHWLLNVVGLFSPLAIFERTNGTVFTGVTLNVLAVTAGLQFCIVG KLLYPNTQVIGLSGVVFSFMSFMAYKEHHTTPVIYTFKYQGSEVSIPTLYSPFIFLIVCM VLIPGSSFWGHLAGISSGYLLALGYIKFLYPPSKAILFIERKLQTPINALRSLVVYYKEE EAIEQRGVSYNPLLSSDPESALNDIPVTTGARTNSFAGEGQVLGAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL
BNC682462-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-500 1x 500 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF568 conjugate, 0.1mg/mL
BNC680874-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details