Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

This Recombinant Salmonella typhimurium Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnU

UniProt

P96064

Expression Region

1-286

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGTLMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M5P Protein Vector (Human) (pPM-C-HA)
35468021 500 ng

OR5M5P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF314P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
69183111 3x 1.0 µg

ZNF314P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
LOC690460 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27479156 3x 1.0 µg DNA

LOC690460 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
mmu-miR-7040-3p miRNA Antagomir
MNM02849 2x 5.0 nmol

mmu-miR-7040-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse Ovalbumin Specific IgE (OVA sIgE) ELISA Kit-Sandwich
EK6F741-01 48 Test

Mouse Ovalbumin Specific IgE (OVA sIgE) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Ovalbumin Specific IgE (OVA sIgE) ELISA Kit-Sandwich
EK6F741-02 96 Tests

Mouse Ovalbumin Specific IgE (OVA sIgE) ELISA Kit-Sandwich

Sign In for Pricing
View Details