Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ycf92 (ycf92)

This Recombinant Uncharacterized protein ycf92 (ycf92) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Uncharacterized protein ycf92

UniProt

P51239

Expression Region

1-287

Origin

Porphyra purpurea

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKFELIPYRLYLSQSRTWMHKIKAEVKIYVLLLLWISFFILSYRKLLIVAFSLIITSST IKCNQYIVKKHFAQTLVMGIAAIMFSFSITNSYQYNLKKEQYRSISSSLAQKTIQRYTPK QITHFNNQISEKLLFAIKPGSYFFITIYSIKLVMITTSSENLALSIYKTKIVNQIFNNEL LFIFLLSSHIFNNIVVKMEKITQIISLRGSLNLLKHSTGIFTLFFLISKLFFSEIIKEST EISQSLYTRNLNQENDNFLKIYTSQIRTNDYICLFICTTYVTILFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL1 Polyclonal Antibody
E914892 100 µL

PPIL1 Polyclonal Antibody

Sign In for Pricing
View Details
GATA5 Mouse Monoclonal Antibody [Clone ID: 1B11]
AM06673SU-N 100 µL

GATA5 Mouse Monoclonal Antibody [Clone ID: 1B11]

Sign In for Pricing
View Details
IL-6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10807R-BF680 100 µL

IL-6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
NAPSA, CT (NAPSA, NAP1, NAPA, Napsin-A, Aspartyl protease 4, Napsin-1, TA01/TA02) (APC) discontinued
038794-APC 200 µL

NAPSA, CT (NAPSA, NAP1, NAPA, Napsin-A, Aspartyl protease 4, Napsin-1, TA01/TA02) (APC) discontinued

Sign In for Pricing
View Details
Caffeine, Ph. Eur., USP grade
GP3094-500g 500 g

Caffeine, Ph. Eur., USP grade

Sign In for Pricing
View Details
Human TADA3 Knockout HEK293T cell line
GTR15414935 1 Vial

Human TADA3 Knockout HEK293T cell line

Sign In for Pricing
View Details