Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ycf92 (ycf92)

This Recombinant Uncharacterized protein ycf92 (ycf92) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Uncharacterized protein ycf92

UniProt

P51239

Expression Region

1-287

Origin

Porphyra purpurea

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKFELIPYRLYLSQSRTWMHKIKAEVKIYVLLLLWISFFILSYRKLLIVAFSLIITSST IKCNQYIVKKHFAQTLVMGIAAIMFSFSITNSYQYNLKKEQYRSISSSLAQKTIQRYTPK QITHFNNQISEKLLFAIKPGSYFFITIYSIKLVMITTSSENLALSIYKTKIVNQIFNNEL LFIFLLSSHIFNNIVVKMEKITQIISLRGSLNLLKHSTGIFTLFFLISKLFFSEIIKEST EISQSLYTRNLNQENDNFLKIYTSQIRTNDYICLFICTTYVTILFLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF6 (C-6)
sc-514644 200 µg/mL

PHF6 (C-6)

Sign In for Pricing
View Details
Vmn2r81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3584407 1.0 µg DNA

Vmn2r81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
(R) - (+) -Bay K 8644
sc-364594B 1 mg

(R) - (+) -Bay K 8644

Sign In for Pricing
View Details
N-Acetyl-O-(4-hydroxy-3,5-diiodophenyl)-3,5-diiodo-L-Tyrosine 2,5-Dioxo-1-pyrrolidinyl Ester (~80%)
A190360 100 mg

N-Acetyl-O-(4-hydroxy-3,5-diiodophenyl)-3,5-diiodo-L-Tyrosine 2,5-Dioxo-1-pyrrolidinyl Ester (~80%)

Sign In for Pricing
View Details
Lentiviral mouse Stk36 shRNA (UAS) - Lentiviral mouse Stk36 shRNA (UAS, RFP) (25)
GTR15112727 1 Vial

Lentiviral mouse Stk36 shRNA (UAS) - Lentiviral mouse Stk36 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Human SET Protein, N-His
orb3058359-01 50 µg

Recombinant Human SET Protein, N-His

Sign In for Pricing
View Details