Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes UPF0761 membrane protein Asuc_0342 (Asuc_0342)

This Recombinant Actinobacillus succinogenes UPF0761 membrane protein Asuc_0342 (Asuc_0342) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Asuc_0342

UniProt

A6VL73

Expression Region

1-287

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTAFTPFASFGKIFLQRFGQNKLLLEAGALTYSTMLAIVPLIMVIFSIFSAFPIFNDVT GVLKEFIFTNFAPSASDVVGQYIDQFVQNSKKMSAVGIISLIVVALMLINSIDNSLNGIW RTPKRGTLFSFAVYWTILTLGPIIMGVSIAISTYVTNLSLFRGELNLPFGIKLLGFVPFI LTWLSFTLIYAIVPNKKINIKHAAAGALVAAVFFTLGKKAFMWYITTFPSYQLIYGAMAT LPLMLLWLQLSWLFILLGAQLAAVLDEIQLEQNNEIHSEQVNNKDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF594 conjugate, 0.1mg/mL
BNC942552-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details