Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haloferax volcanii Protein translocase subunit SecF (secF)

This Recombinant Haloferax volcanii Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

D4GTK4

Expression Region

1-287

Origin

Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEFTVPEVDYTRYTNRQLAAVPLAVLAVALLVIGGWYVATGAPVNPGVDFTGGTELRIA TDAPQSEVAAAFDSQPESIRSVAADGTYVVTFQSGSATSTELQTQAEDAGFEVRSIDAVS ANFGGETQLLALGGLAVAFAGMSVLVFAMFRSFVPSIAVVLSAFSDIVIPVALMNLFGIE LSLGTVAALLMLIGYSVDSDILLNNHVLRRSGDFYESTARAMRTGVTMTLTSIAAMIVMT IMATLFGIQLLAAIGTVLVFGLTADLMNTYMLNVTLLRWYKFEGVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclosporin D
TRC-C988910-1MG 1 mg

Cyclosporin D

Sign In for Pricing
View Details
Myeloid zinc finger 1 (MZF1) Human Gene Knockout Kit (CRISPR)
KN202865LP 1 Kit

Myeloid zinc finger 1 (MZF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat ICAM1 Recombinant Rabbit monoclonal Antibody
HA723926 100 µL

Rat ICAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]
TA505855AM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12B8]

Sign In for Pricing
View Details
Epoxide hydrolase (EPHX1) (NM_001136018) Human Over-expression Lysate
LC427767 20 µg

Epoxide hydrolase (EPHX1) (NM_001136018) Human Over-expression Lysate

Sign In for Pricing
View Details
Stathmin 1 (STMN1) (NM_005563) Human Recombinant Protein
TP313958M 100 µg

Stathmin 1 (STMN1) (NM_005563) Human Recombinant Protein

Sign In for Pricing
View Details