Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecF (secF)

This Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

O26936

Expression Region

1-287

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGETLKVIVLIDRILKSYRPLIAIPAAITVIALLLVVFNGLNESVDLKGGALAELTLEKS VTQAELESLLREKLGTGDIKVLSIRGERVTVQFGTDMDVVKVSEALRGTATINSYKAVGP VLSKQAMNQIYWAIGFAFLFMSVTVFIIFRDPVPSLAVILAAASDIIIAVGGMSLFGIPL SLASVGAILMLIGYSVDTDILLTTRVLKRRKGTINERALGAMKTGVTMSIAAIASMAALY LVTVFVMPEARVLSDIAAVLIIGLLADILTTWLMNLGILRWYLEVRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR2A25 sgRNA gene knockout kit - Lentiviral human OR2A25 sgRNA gene knockout kit (plasmid)
GTR15368630 1 Vial

Lentiviral human OR2A25 sgRNA gene knockout kit - Lentiviral human OR2A25 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HIV-1, C5 (gp120)
301815 100 µg

HIV-1, C5 (gp120)

Sign In for Pricing
View Details
CD9 (Biotin) discontinued
516500-01 25 µg

CD9 (Biotin) discontinued

Sign In for Pricing
View Details
CD9 (Biotin) discontinued
516500-02 100 µg

CD9 (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG (H&L) - HRP
CSA2125-01 100 µL

Rabbit Anti-Horse IgG (H&L) - HRP

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG (H&L) - HRP
CSA2125-02 500 μL

Rabbit Anti-Horse IgG (H&L) - HRP

Sign In for Pricing
View Details