Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecF (secF)

This Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

O26936

Expression Region

1-287

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGETLKVIVLIDRILKSYRPLIAIPAAITVIALLLVVFNGLNESVDLKGGALAELTLEKS VTQAELESLLREKLGTGDIKVLSIRGERVTVQFGTDMDVVKVSEALRGTATINSYKAVGP VLSKQAMNQIYWAIGFAFLFMSVTVFIIFRDPVPSLAVILAAASDIIIAVGGMSLFGIPL SLASVGAILMLIGYSVDTDILLTTRVLKRRKGTINERALGAMKTGVTMSIAAIASMAALY LVTVFVMPEARVLSDIAAVLIIGLLADILTTWLMNLGILRWYLEVRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken anti-dsDNA IgG-specific ELISA Kit
MBS2601463-01 48 Well

Chicken anti-dsDNA IgG-specific ELISA Kit

Sign In for Pricing
View Details
Chicken anti-dsDNA IgG-specific ELISA Kit
MBS2601463-02 96 Well

Chicken anti-dsDNA IgG-specific ELISA Kit

Sign In for Pricing
View Details
Chicken anti-dsDNA IgG-specific ELISA Kit
MBS2601463-03 5x 96 Well

Chicken anti-dsDNA IgG-specific ELISA Kit

Sign In for Pricing
View Details
Chicken anti-dsDNA IgG-specific ELISA Kit
MBS2601463-04 10x 96 Well

Chicken anti-dsDNA IgG-specific ELISA Kit

Sign In for Pricing
View Details
PD-L1 Antibody
ASA-B1491 1 Each

PD-L1 Antibody

Sign In for Pricing
View Details
Anti-IMP-3  (3B12)
YF-MA11305 200 ul

Anti-IMP-3 (3B12)

Sign In for Pricing
View Details