Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ycf92 (ycf92)

This Recombinant Uncharacterized protein ycf92 (ycf92) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Uncharacterized protein ycf92

UniProt

Q1XDP8

Expression Region

1-287

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATFELIPYRLYLSQSNTWIHRIKAEIKIYIVALLWISIFIFSYFKLCIIALSLIAISFT IRSKQNIIQKHLLQTLLMTFLTTVLSFSVAISYKQYAEQEQSQYLSDSKKYKNSSSYYYI QIANDQRIKRQYLITTLKPSLYFFITIYSIKLVMITTSPEVLVITIYRSRIINKIFKNEL LFIFLLSSHIVTSIINRIDKVIQVTSLRGSLNLYNSLTRPLMFSLLIFQVFFLEIIRESK EIAQALYTRNLNQENNNFLKIYTVKSNFSDRLNIIISTLYFIILALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SHF Antibody
NBP2-83519-0.1mL 0.1 mL

Rabbit Polyclonal SHF Antibody

Sign In for Pricing
View Details
CIS-1 (Cytokine-Inducible SH2-containing Protein-1, Suppressor of Cytokine Signalling, SOCS, Protein G18, CISH) (MaxLight 490)
MBS6374022-01 0.1 mL

CIS-1 (Cytokine-Inducible SH2-containing Protein-1, Suppressor of Cytokine Signalling, SOCS, Protein G18, CISH) (MaxLight 490)

Sign In for Pricing
View Details
CIS-1 (Cytokine-Inducible SH2-containing Protein-1, Suppressor of Cytokine Signalling, SOCS, Protein G18, CISH) (MaxLight 490)
MBS6374022-02 5x 0.1 mL

CIS-1 (Cytokine-Inducible SH2-containing Protein-1, Suppressor of Cytokine Signalling, SOCS, Protein G18, CISH) (MaxLight 490)

Sign In for Pricing
View Details
FAM161A Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-8216R-PerCP-Cy5.5 100 µL

FAM161A Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Micromer® streptavidin
01-19-803 1 mL

Micromer® streptavidin

Sign In for Pricing
View Details
Rpl3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3683205 3x 1.0 µg

Rpl3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details