Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris Type 4 prepilin-like proteins leader peptide-processing enzyme (xpsO)

This Recombinant Xanthomonas campestris pv. campestris Type 4 prepilin-like proteins leader peptide-processing enzyme (xpsO) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

Q56763

Expression Region

1-287

Origin

Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLDQHPGLGFPAAAGLGLLIGSFLNVVILRLPKRMEWQWRRDAREILELPDIYEPPPP GIVVEPSHDPVTGDKLKWWENIPLFSWLMLRGKSRYSGKPISIQYPLVELLTSILCVASV WRFGFGWQGFGAIVLSCFLVAMSGIDLRHKLLPDQLTLPLMWLGLVGSMDNLYMPAKPAL LGAAVGYVSLWTVWWLFKQLTGKEGMGHGDFKLLAALGAWCGLKGILPIILISSLVGAVL GSIWLFAKGRDRATPIPFGPYLAIAGWVVFFWGNDLVDGYLRFAGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD6 Antibody
orb672605-01 50 µg

C2CD6 Antibody

Sign In for Pricing
View Details
C2CD6 Antibody
orb672605-02 100 µg

C2CD6 Antibody

Sign In for Pricing
View Details
Recombinant Rat CD150/SLAM Protein (His Tag)
PKSR030210 100 µg

Recombinant Rat CD150/SLAM Protein (His Tag)

Sign In for Pricing
View Details
Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT
E2166Hu-01 48 Well

Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT

Sign In for Pricing
View Details
Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT
E2166Hu-02 96 Well

Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT

Sign In for Pricing
View Details
Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT
E2166Hu-03 5x 96 Tests

Human G protein-activated inward rectifier potassium channel 4, KCNJ5 ELISA KIT

Sign In for Pricing
View Details