Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mannheimia succiniciproducens UPF0761 membrane protein MS0032 (MS0032)

This Recombinant Mannheimia succiniciproducens UPF0761 membrane protein MS0032 (MS0032) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

UPF0761 membrane protein MS0032

UniProt

Q65WM1

Expression Region

1-287

Origin

Mannheimia succiniciproducens (strain MBEL55E)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRVVMTQLKLLFAVFYCRFQQNKLTQAAGALTYSTMLAIVPLVMVVFAIFSAFPMFNEA AAELKTFIFDNFSPSAGDTVGQYIDEFVVNSKSMSAVGIISLIAVALLLINQIDRTINDI WNSKNRNFIFSMTIYWTLLTLGPIFIGMSFAINTYIRSIIAFEGDLGLPFGLKLLSFVPF LLTWLSFSLIYTLVPNTKVNFRYAAVGALVAAIFFTLGKKAFAWYMATFPSYQLIYGAMA TLPITLLWIQLSWLFILLGAQLTAVLGDMRLIKSGDLNLTAIKEKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details