Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial dicarboxylate carrier (Slc25a10)

This Recombinant Mouse Mitochondrial dicarboxylate carrier (Slc25a10) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Mitochondrial dicarboxylate carrier, Solute carrier family 25 member 10

UniProt

Q9QZD8

Expression Region

1-287

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEARASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALY NGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPAD LVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSC YDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCA METAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFGIKVPTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM1 (TRAPPC10) (NM_003274) Human Recombinant Protein
TP310998L 1 mg

TMEM1 (TRAPPC10) (NM_003274) Human Recombinant Protein

Sign In for Pricing
View Details
Beta actin Monoclonal Antibody
AN005290L-01 25 µL

Beta actin Monoclonal Antibody

Sign In for Pricing
View Details
Beta actin Monoclonal Antibody
AN005290L-02 100 µL

Beta actin Monoclonal Antibody

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker), 0.2mg/mL
BNUB1657-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), 0.2mg/mL

Sign In for Pricing
View Details
Interferon alpha 2 Recombinant Rabbit monoclonal Antibody
HA751214 100 µL

Interferon alpha 2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS623950 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details