Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA (pstA)

This Recombinant Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

Q9PBK1

Expression Region

1-287

Origin

Xylella fastidiosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTASQHLYKRRRLINATAITISCIAALFGLFFLIWILWTLISKGLPGIGLDLFTKITPP PMQKGGLANAFFGSAIMCLLAIVIGTPLGIAAGTWLAEYGNTSKTSAVVRFVNDILLSAP SIVLGLFVYTLYVMHTGGHFSAFSGALALVFIVLPIVVRTTDEMLRLVPGQMREAALSLG IPQWKMIIQVLYRSASAGILTGILLALARISGETAPLLFTAFGNQYWSSNIFQPIASLPL VMNQFASSPYKSWQLLAWSGALVLTVFVLLVSLGARTLLLRNKIPNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPRT1 AAV Vector (Human) (CMV)
31454101 1 µg

NAPRT1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PAR1 Peptide
MBS544117-01 0.25 mg

PAR1 Peptide

Sign In for Pricing
View Details
PAR1 Peptide
MBS544117-02 5x 0.25 mg

PAR1 Peptide

Sign In for Pricing
View Details
Euonymus europaeus Lectin (EEL/EEA) - Texas Red
21761023-1 Inquire

Euonymus europaeus Lectin (EEL/EEA) - Texas Red

Sign In for Pricing
View Details
Phospho-CPI17alpha (Thr38) Blocking Peptide
MBS9615825-01 1 mg

Phospho-CPI17alpha (Thr38) Blocking Peptide

Sign In for Pricing
View Details
Phospho-CPI17alpha (Thr38) Blocking Peptide
MBS9615825-02 5x 1 mg

Phospho-CPI17alpha (Thr38) Blocking Peptide

Sign In for Pricing
View Details