Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidovorax sp. ATP synthase subunit a (atpB)

This Recombinant Acidovorax sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1W2T1

Expression Region

1-287

Origin

Acidovorax sp. (strain JS42)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADAHAPTASEYIVHHLQHLQNIKQKSIIDFSVVNLDSVAVSVILGVLGLFVMWLAART ATSGVPSRFQAAVEMLVEMVDNQAKANIHNAQSRKFIAPLALTVFVWIFLMNAMDLLPVD LLPVLWQVATGDSHAYLRVVPTADLSTTLGLSSAVLILCFVYSIKIKGLGGWAHELVTAP FGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFGNMYAGELVFMLIALMGGAAAMS LSGVLLPVGHIIAGSIWAIFHILIITLQAFIFMMLTLIYLGQAHEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (ASTRO/789), CF647 conjugate, 0.1mg/mL
BNC470789-100 1x 100 µL

GFAP (ASTRO/789), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF594 conjugate, 0.1mg/mL
BNC942148-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details