Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Spermidine/putrescine transport system permease protein PotB (potB)

This Recombinant Salmonella typhimurium Spermidine/putrescine transport system permease protein PotB (potB) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Spermidine/putrescine transport system permease protein PotB

UniProt

P0CL49

Expression Region

1-287

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNTSKFQNVVIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYARLLDPL YFEVLLHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRIYGL KIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPL LEAARDLGASKMQTFIRIIIPLTMPGIVAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVI KVQFLNIRDWPFGAATSITLTIVMGLMLLIYWRASRLLNKKVSDISD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF568 conjugate, 0.1mg/mL
BNC681192-500 1x 500 µL

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL
BNC040287-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF594 conjugate, 0.1mg/mL
BNC942174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details