Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 163 (Tmem163)

This Recombinant Mouse Transmembrane protein 163 (Tmem163) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Transmembrane protein 163, Synaptic vesicle membrane protein of 31 kDa

UniProt

Q8C996

Expression Region

1-288

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPALGSERRSPPGPGVPRPPPRGHAPSTAAPAPSPAPMSSSVQSDEERQPRISESGQFS DGLEDRGLLESSTRLKPHEAQNYRKKALWVSWLSIIVTLALAVAAFTVSVMRYSASAFGF AFDAILDVLSSAIVLWRYSNAAAVHSANREYIACVILGVIFLLSSICIVVKAIHDLSTRL LPEVDDFLFSVSILSGILCSVLAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSAE VFKHNAAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 zeta (YWHAZ) pSer58 Rabbit Polyclonal Antibody
AP02457PU-S 50 µL

14-3-3 zeta (YWHAZ) pSer58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM168B (NM_001009993) Human Over-expression Lysate
LC423171 20 µg

FAM168B (NM_001009993) Human Over-expression Lysate

Sign In for Pricing
View Details
Bmi1 Mouse Gene Knockout Kit (CRISPR)
KN502190 1 Kit

Bmi1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF405S conjugate, 0.1mg/mL
BNC042670-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCP1A Polyclonal Antibody
E-AB-11140-01 20 µL

DCP1A Polyclonal Antibody

Sign In for Pricing
View Details
DCP1A Polyclonal Antibody
E-AB-11140-02 60 µL

DCP1A Polyclonal Antibody

Sign In for Pricing
View Details