Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 163 (Tmem163)

This Recombinant Mouse Transmembrane protein 163 (Tmem163) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Transmembrane protein 163, Synaptic vesicle membrane protein of 31 kDa

UniProt

Q8C996

Expression Region

1-288

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPALGSERRSPPGPGVPRPPPRGHAPSTAAPAPSPAPMSSSVQSDEERQPRISESGQFS DGLEDRGLLESSTRLKPHEAQNYRKKALWVSWLSIIVTLALAVAAFTVSVMRYSASAFGF AFDAILDVLSSAIVLWRYSNAAAVHSANREYIACVILGVIFLLSSICIVVKAIHDLSTRL LPEVDDFLFSVSILSGILCSVLAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSAE VFKHNAAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-,  20nm
GP-2301-20 1 mL

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 20nm

Sign In for Pricing
View Details
Cyanoacetic Acid-13C2
TRC-C987482-250MG 250 mg

Cyanoacetic Acid-13C2

Sign In for Pricing
View Details
PIP5K3 (PIKFYVE) (NM_001178000) Human Recombinant Protein
TP330258 20 µg

PIP5K3 (PIKFYVE) (NM_001178000) Human Recombinant Protein

Sign In for Pricing
View Details
EPHX2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F6]
TA501628AM 100 µL

EPHX2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F6]

Sign In for Pricing
View Details
CNOT1 Human Gene Knockout Kit (CRISPR)
KN206903LP 1 Kit

CNOT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP02556PU-N 100 µL

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details