Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB)

This Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4FQ31

Expression Region

1-288

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGEQTTTEYISHHLTNWTYGYLPGEGWKVAYTAEEASAMGFKAIHLDSMLWSIGLGIVF CAIFWMVARKVTSGVPGKLQAAVEMIIEFVDNNVRDSYSGTSKLIAPLALTIFVWIFLMN LMDLLPVDFVPGLAGQIGAMMGHDPHHVFFKIVPTTDPNITLGMSFSVFILILFYSIKEK GLGGFVGELTLHPFSAKNPIVQIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFI LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYMSLASSTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI4G5]
CF808359 100 µg

CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI4G5]

Sign In for Pricing
View Details
CABP4 (NM_001300895) Human Tagged ORF Clone
RG236245 10 µg

CABP4 (NM_001300895) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS710834 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
WDFY4 Rabbit Polyclonal Antibody
TA369748 100 µL

WDFY4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EAAT2 Recombinant Chimeric Antibody Antibody
HA601504 100 µL

EAAT2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
DOK3 (NM_001144876) Human Over-expression Lysate
LC428537 20 µg

DOK3 (NM_001144876) Human Over-expression Lysate

Sign In for Pricing
View Details